PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G18470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 1138aa    MW: 124684 Da    PI: 7.8494
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G18470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.7e-40184261178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv++C+adl++ak+yhrrhkvCe+h k++++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  OPUNC08G18470.1 184 MCQVDDCRADLTNAKDYHRRHKVCEIHGKTTKALVGNQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 261
                      6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.3E-34177246IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.949182259IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-37183262IPR004333Transcription factor, SBP-box
PfamPF031102.5E-29185258IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1138 aa     Download sequence    Send to blast
MQREVGPQVA PPMFLHQIQP LPPHATAAKK RGNPWPAAAA AEAAGGANWN PRMWDWDSRA  60
LTAKPSSDAL RVNAGLSHHH HHHHQQQSPP AVAKAAEALR QGGGGSGGLN LQLGLREDAA  120
THMDVSPAAT TVSSSPSPPP SSAPAQEPVV RPSKRVRSGS PGSASGGGGG GGGGGGNSGG  180
SYPMCQVDDC RADLTNAKDY HRRHKVCEIH GKTTKALVGN QMQRFCQQCS RFHPLSEFDE  240
GKRSCRRRLA GHNRRRRKTQ PTDVASQLLL PGNQENAANR TQDIVNLITV IARLQGSNVG  300
KLPSIPPIPD KDNLVQIISK INSINNTNSA SKSPPSEAVD LNASHSQQQD SVRRTTNGFE  360
KQTNGFDKQT NGFDKQTNGF DKQAVPSTMD LLAVLSTALA TSNPDSNTSQ SQGSSDSSGN  420
NKSKSQSTEP TNVVNSHEKS IRVFSATRKN DALESSPEMY KQPDKETQPY LSLRLFGSTE  480
EDVPCKMDTA NKYLSSESSN PLDERSPSSS PPITHKFFPI RSVDEDARIA DYGEDIATVE  540
VSTSRPWRAP PLELFKDSER PIENGSPPNP AYQSCYTSTS CSDHSPSTSN SDGQDRTGRI  600
IFKLFGKEPS TIPGNLRGEI VNWLKHSPTE MEGYIRPGCL VLSMYLSMPA IAWDELEENL  660
LQRVNTLVQG SDLDFWRKGR FLVRTDAQLV SYKDGATRIS KSWRTWNTPE LTFVSPIAVV  720
GGRKTSLILK GRNLTIPGTQ IHCTSTGKYI SKEVLCSAYP GTIYDDSGVE TFDLPGEPHL  780
ILGRCFIEVE NRFRGNSFPV IIANSSVCQE LRSLEAELEG SQFVDGSSDE QAHDARRLKP  840
KDEVLHFLNE LGWLFQKAAA STSAEKSDSS GLDLMYFSTA RFRYLLLFSS ERDWCSLTKT  900
LLEILAKRSL ASDELSQETL EMLSEIHLLN RAVKRRSSHM ARLLVQFVVV CPDDSKLYPF  960
LPNVAGPGGL TPLHLAASIE NAVDIVDALT DDPQQIGLSC WHSVLDDDGQ SPETYAKLRN  1020
NNSYNELVAQ KLVDRKNNQV TIMVGKEEIH MDQPGNVGEK NKSAIQALQI RTCNQCAILD  1080
AGLLRRPLHS RGLLARPYIH SMLAIAAVCV CVCVFMRALL RFNSGRSFKW ERLDFGTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-32173258184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1930935RAVKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2420700.0AK242070.1 Oryza sativa Japonica Group cDNA, clone: J075133L10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649921.10.0PREDICTED: squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
TrEMBLA0A0E0LWU60.0A0A0E0LWU6_ORYPU; Uncharacterized protein
STRINGORGLA08G0179900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14